PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538823.1_FGP025
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 212aa    MW: 24068 Da    PI: 9.7776
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538823.1_FGP025genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF817.7e-261058250
                       ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
             SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                       rien   rqvtf+kRr g+lKKA ELSvLCda+v viifss+gkl+e +
  KN538823.1_FGP025 10 RIENPVHRQVTFCKRRGGLLKKARELSVLCDADVGVIIFSSQGKLHELA 58
                       8*********************************************965 PP

2K-box492.6e-17881701698
              K-box  16 slqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                          +q +  L++ei+ Lqr +R   G + ++++l  L+ Le+ Le  + +iR++K++++ ++i+ l++ke  l+ +n++L++k 
  KN538823.1_FGP025  88 VAEQGIFLLREEIDLLQRGLRSTYGGGAGEMTLDKLHALEKGLELWIYQIRTTKMQMMQQEIQFLRNKEGILKAANEMLQEKS 170
                        55677778************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.8E-35160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.959161IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.98E-28174IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002652.67E-37373No hitNo description
PRINTSPR004044.0E-26323IPR002100Transcription factor, MADS-box
PfamPF003197.0E-241056IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129710.38786176IPR002487Transcription factor, K-box
PfamPF014865.3E-1887169IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MVRGKAQMRR IENPVHRQVT FCKRRGGLLK KARELSVLCD ADVGVIIFSS QGKLHELATN  60
GNMHNLVERY QSNVAGGQME PGALQRQVAE QGIFLLREEI DLLQRGLRST YGGGAGEMTL  120
DKLHALEKGL ELWIYQIRTT KMQMMQQEIQ FLRNKEGILK AANEMLQEKS TTNTTNDLRK  180
SLLLNLAVKD LGQFNSGCIY KACLSFKEYM LY
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1777000.0AY177700.1 Oryza sativa (japonica cultivar-group) transcription factor MADS33 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618440.11e-118PREDICTED: MADS-box transcription factor 33
SwissprotQ2QW551e-119MAD33_ORYSJ; MADS-box transcription factor 33
TrEMBLA3CFV11e-119A3CFV1_ORYSJ; Uncharacterized protein
TrEMBLA2ZIY81e-119A2ZIY8_ORYSI; Putative uncharacterized protein
TrEMBLA0A0E0J7X21e-119A0A0E0J7X2_ORYNI; Uncharacterized protein
TrEMBLA0A0E0BQC51e-119A0A0E0BQC5_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0FAI81e-119A0A0E0FAI8_9ORYZ; Uncharacterized protein
STRINGBGIOSGA036463-PA1e-119(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.12e-58AGAMOUS-like 12